
Atlas Antibodies Anti-POGLUT1 Antibody
상품 한눈에 보기
Human POGLUT1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성(인간, 쥐, 생쥐) 확인. 안정적 PBS/glycerol 버퍼에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-POGLUT1 Antibody
Target Protein: protein O-glucosyltransferase 1 (POGLUT1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) with recombinant expression validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human POGLUT1
Alternative Gene Names
9630046K23Rik, C3orf9, hCLP46, KDELCL1, KTELC1, MDS010, MDSRP, MGC32995, Rumi
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VQELLQFVKANDDVAQEIAERGSQFIRNHLQMDDITCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000003014 | 89% |
| Mouse | ENSMUSG00000034064 | 86% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-POGZ Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POGZ Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POGLUT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POGLUT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POFUT1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.