
Atlas Antibodies Anti-PNPO Antibody
상품 한눈에 보기
Human PNPO 단백질을 인식하는 Rabbit polyclonal 항체로, IHC, WB, ICC에 적합. 독립적 항체 검증을 통해 높은 특이성과 재현성을 확보. PrEST 항원을 이용한 친화 정제 방식으로 높은 순도 제공. Human에 대해 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PNPO Antibody
Target Protein: Pyridoxamine 5'-phosphate oxidase (PNPO)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human PNPO.
Alternative Gene Names
- PDXPO
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Pyridoxamine 5'-phosphate oxidase |
| Target Gene | PNPO |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | SSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (92%), Rat (90%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PNPLA5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNPLA7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNPO Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNPLA6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNPLA2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.