
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PNPO Antibody
상품 한눈에 보기
Human PNPO 단백질을 인식하는 Rabbit polyclonal 항체로, IHC, WB, ICC에 적합. 독립적 항체 검증을 통해 높은 특이성과 재현성을 확보. PrEST 항원을 이용한 친화 정제 방식으로 높은 순도 제공. Human에 대해 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA023204-100 Anti-PNPO Antibody, pyridoxamine 5`-phosphate oxidase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023204-25 Anti-PNPO Antibody, pyridoxamine 5`-phosphate oxidase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PNPO Antibody
Anti-PNPO Antibody
Target Protein: Pyridoxamine 5'-phosphate oxidase (PNPO)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human PNPO.
Alternative Gene Names
- PDXPO
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Pyridoxamine 5'-phosphate oxidase |
| Target Gene | PNPO |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | SSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (92%), Rat (90%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



