
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PLP2 Antibody
상품 한눈에 보기
Human PLP2 단백질을 인식하는 토끼 폴리클로날 항체로, colonic epithelium-enriched 단백질 연구에 적합. Affinity purification 방식으로 정제되었으며, IHC 등 다양한 응용에 사용 가능. 40% glycerol/PBS buffer에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042415-100 Anti-PLP2 Antibody, proteolipid protein 2 (colonic epithelium-enriched) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042415-25 Anti-PLP2 Antibody, proteolipid protein 2 (colonic epithelium-enriched) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PLP2 Antibody
Anti-PLP2 Antibody
Target: Proteolipid protein 2 (colonic epithelium-enriched)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human PLP2 (proteolipid protein 2), produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- A4
- A4-LSB
- MGC126187
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Proteolipid protein 2 (colonic epithelium-enriched) |
| Target Gene | PLP2 |
| Antigen Sequence | RGNHSKIVAGVKAMGAALKHRAKGLRSQGPFLP |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000029260 (36%), Mouse ENSMUSG00000067649 (36%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



