
Atlas Antibodies Anti-PLP2 Antibody
상품 한눈에 보기
Human PLP2 단백질을 인식하는 토끼 폴리클로날 항체로, colonic epithelium-enriched 단백질 연구에 적합. Affinity purification 방식으로 정제되었으며, IHC 등 다양한 응용에 사용 가능. 40% glycerol/PBS buffer에 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PLP2 Antibody
Target: Proteolipid protein 2 (colonic epithelium-enriched)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human PLP2 (proteolipid protein 2), produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- A4
- A4-LSB
- MGC126187
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Proteolipid protein 2 (colonic epithelium-enriched) |
| Target Gene | PLP2 |
| Antigen Sequence | RGNHSKIVAGVKAMGAALKHRAKGLRSQGPFLP |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000029260 (36%), Mouse ENSMUSG00000067649 (36%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
