Atlas Antibodies Anti-PLGRKT Antibody
| 상품 옵션 정보 | |||||||
|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA008214-100 | Atlas Antibodies HPA008214-100 Anti-PLGRKT Antibody, plasminogen receptor, C-terminal lysine transmembrane protein 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA008214-25 | Atlas Antibodies HPA008214-25 Anti-PLGRKT Antibody, plasminogen receptor, C-terminal lysine transmembrane protein 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-PLGRKT Antibody
plasminogen receptor, C-terminal lysine transmembrane protein
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human PLGRKT
Alternative Gene Names
AD025, C9orf46, FLJ14688, MDS030, Plg-RKT
Target Protein
plasminogen receptor, C-terminal lysine transmembrane protein
Target Gene
PLGRKT
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
QKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSRE
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000015932 (89%)
Mouse ENSMUSG00000016495 (81%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|