
Atlas Antibodies Anti-PLEKHF2 Antibody
상품 한눈에 보기
Human PLEKHF2 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 Western Blot에 적합. PrEST 항원을 이용해 친화 정제됨. 높은 종 간 반응성(인간, 마우스, 랫트) 확인. 안정한 PBS/glycerol buffer에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PLEKHF2 Antibody
Target: pleckstrin homology domain containing, family F (with FYVE domain) member 2
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal Antibody against Human PLEKHF2
Alternative Gene Names
FLJ13187, PHAFIN2, ZFYVE18
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | pleckstrin homology domain containing, family F (with FYVE domain) member 2 |
| Target Gene | PLEKHF2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000049969 (99%), Rat ENSRNOG00000026662 (98%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Antigen Sequence
VYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTPSN
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PLEKHG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLEKHG2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLEKHF2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLEKHG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLEKHF1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.