AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PLEKHA6 Antibody
상품 한눈에 보기
인간 PLEKHA6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 40% 글리세롤 및 PBS 완충액에 보존되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028157-100 Anti-PLEKHA6 Antibody, pleckstrin homology domain containing A6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028157-25 Anti-PLEKHA6 Antibody, pleckstrin homology domain containing A6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PLEKHA6 Antibody
Anti-PLEKHA6 Antibody
Target: pleckstrin homology domain containing, family A member 6 (PLEKHA6)
Type: Polyclonal Antibody against Human PLEKHA6
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody is raised in rabbit against the human PLEKHA6 protein. It is affinity purified using the PrEST antigen as an affinity ligand, ensuring high specificity and reproducibility.
Alternative Gene Names
- KIAA0969
- PEPP3
Antigen Information
Antigen Sequence (PrEST):
SIHEVDISNLEAALRAEEPGGHAYETPREEIARLRKMELEPQHYDVDINKELSTPDKVLIPERYIDLEPDTPLSPEELKEKQ
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000041757 | 98% |
| Rat | ENSRNOG00000024602 | 32% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide |
| Purification Method | Affinity purified using PrEST antigen |
| Storage | Store at -20°C (recommended) |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.