
Atlas Antibodies Anti-PLEKHA6 Antibody
인간 PLEKHA6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 40% 글리세롤 및 PBS 완충액에 보존되어 있습니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PLEKHA6 Antibody
Target: pleckstrin homology domain containing, family A member 6 (PLEKHA6)
Type: Polyclonal Antibody against Human PLEKHA6
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody is raised in rabbit against the human PLEKHA6 protein. It is affinity purified using the PrEST antigen as an affinity ligand, ensuring high specificity and reproducibility.
Alternative Gene Names
- KIAA0969
- PEPP3
Antigen Information
Antigen Sequence (PrEST):
SIHEVDISNLEAALRAEEPGGHAYETPREEIARLRKMELEPQHYDVDINKELSTPDKVLIPERYIDLEPDTPLSPEELKEKQ
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000041757 | 98% |
| Rat | ENSRNOG00000024602 | 32% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide |
| Purification Method | Affinity purified using PrEST antigen |
| Storage | Store at -20°C (recommended) |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PLEKHA6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLEKHA7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLEKHA6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLEKHA7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLEKHA6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|