Atlas Antibodies Anti-PLA2G15 Antibody

상품 한눈에 보기

인간 PLA2G15 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합합니다. 독립 항체 간 비교 검증을 통해 신뢰성 확보. Rabbit 유래 IgG, PrEST 항원으로 친화 정제. Human 반응성 확인.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041727-100 Anti-PLA2G15 Antibody, phospholipase A2, group XV 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041727-25 Anti-PLA2G15 Antibody, phospholipase A2, group XV 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: phospholipase A2, group XV
Supplier: Atlas Antibodies

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human PLA2G15

GXVPLA2, LLPL, LYPLA3

항목	내용
Target Protein	phospholipase A2, group XV
Target Gene	PLA2G15
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	GVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFED
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000019859 (92%), Mouse ENSMUSG00000031903 (91%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand