CacheBy
Atlas Antibodies Anti-PKDCC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PKDCC Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-PKDCC Antibody는 인간 PKDCC 단백질을 인식하는 고품질 폴리클로날 항체입니다. IHC 및 WB 분석에 적합하며, RNA-seq 데이터 기반 Orthogonal validation을 거쳤습니다. Rabbit 유래 IgG 항체로 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA026427-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026427-100 Anti-PKDCC Antibody, protein kinase domain containing, cytoplasmic 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026427-25 Anti-PKDCC Antibody, protein kinase domain containing, cytoplasmic 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PKDCC Antibody

Anti-PKDCC Antibody

protein kinase domain containing, cytoplasmic


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Orthogonal validation)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human PKDCC


Alternative Gene Names

  • SgK493
  • Vlk

Open Datasheet


Target Information

항목 내용
Target Protein protein kinase domain containing, cytoplasmic
Target Gene PKDCC
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence STDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQ
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000024247 (93%), Rat ENSRNOG00000004205 (91%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.