
Atlas Antibodies Anti-PKD2 Antibody
상품 한눈에 보기
Human PKD2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. Affinity purification 방식으로 제조되었으며, 높은 종 간 보존성과 특이성을 제공합니다. 40% glycerol 기반 buffer에 보존되어 안정적입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PKD2 Antibody
Overview
Polyclonal antibody against Human PKD2 (polycystic kidney disease 2, autosomal dominant).
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
- Type: Polyclonal Antibody
- Target Protein: Polycystic kidney disease 2 (autosomal dominant)
- Target Gene: PKD2
- Alternative Gene Names: Pc-2, PC2, PKD4, TRPP2
- Host: Rabbit
- Isotype: IgG
- Clonality: Polyclonal
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
REDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISH
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000002146 | 96% |
| Mouse | ENSMUSG00000034462 | 96% |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PKD2L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PKD2L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PKD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PJA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PKD1L1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.