Thermo Fisher Scientific KV1.6 (KCNA6) Polyclonal Antibody
Rabbit polyclonal antibody against KV1.6 (KCNA6) for WB, IHC, and ICC/IF applications. Lyophilized form, reconstitute with 50 µL deionized water. Targets rat Kv1.6 residues 463–530. Suitable for research use only.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:350 |
| Immunohistochemistry (IHC) | Assay-Dependent |
| Immunocytochemistry (ICC/IF) | 1:200 |
Product Specifications
| Property | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463–530 of rat Kv1.6 |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.3 mg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2736061 |
Product Specific Information
Product is shipped at room temperature as a lyophilized powder and should be stored at -20°C upon receipt.
Reconstitution: add 50 µL of deionized water.
Target Information
Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
Four sequence-related potassium channel genes—shaker, shaw, shab, and shal—have been identified in Drosophila, and each has a human homolog.
This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class. The coding region of this gene is intronless, and the gene is clustered with genes KCNA1 and KCNA5 on chromosome 12.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Kir3.2 (KCNJ6) Polyclonal Antibody
949,900원
Thermo Fisher Scientific
Thermo Fisher Scientific Kir3.1 (KCNJ3) Polyclonal Antibody
922,300원
Thermo Fisher Scientific
Thermo Fisher Scientific KV1.6 (KCNA6) Polyclonal Antibody
Thermo Fisher Scientific
Thermo Fisher Scientific KV1.5 (KCNA5) Polyclonal Antibody
922,300원
Thermo Fisher Scientific
Thermo Fisher Scientific Kir1.1 (KCNJ1) Polyclonal Antibody
943,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|