CacheBy
Thermo Fisher Scientific KV1.6 (KCNA6) Polyclonal Antibody
원본

Thermo Fisher Scientific KV1.6 (KCNA6) Polyclonal Antibody

상품 한눈에 보기

Rabbit polyclonal antibody against KV1.6 (KCNA6) for WB, IHC, and ICC/IF applications. Lyophilized form, reconstitute with 50 µL deionized water. Targets rat Kv1.6 residues 463–530. Suitable for research use only.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 03. 오후 07:12
Thermo Fisher Scientific PA577572 KV1.6 (KCNA6) Polyclonal Antibody 50 ul pk판매 단위 pk ·
재고 확인 필요
견적요청

Thermo Fisher Scientific · Thermo Fisher Scientific KV1.6 (KCNA6) Polyclonal Antibody

Applications

Application Tested Dilution
Western Blot (WB) 1:350
Immunohistochemistry (IHC) Assay-Dependent
Immunocytochemistry (ICC/IF) 1:200

Product Specifications

Property Description
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen GST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463–530 of rat Kv1.6
Conjugate Unconjugated
Form Lyophilized
Concentration 0.3 mg/mL
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2736061

Product Specific Information

Product is shipped at room temperature as a lyophilized powder and should be stored at -20°C upon receipt.
Reconstitution: add 50 µL of deionized water.

Target Information

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
Four sequence-related potassium channel genes—shaker, shaw, shab, and shal—have been identified in Drosophila, and each has a human homolog.
This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class. The coding region of this gene is intronless, and the gene is clustered with genes KCNA1 and KCNA5 on chromosome 12.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

PA5-77572_KV1.6_KCNA6_P17659-1_Rabbit.svg
PA5-77572_KV1.6_KCNA6_P17659-1_Rabbit_PDP.jpeg

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.