
원본
Thermo Fisher Scientific Prostate Specific Acid Phosphatase Polyclonal Antibody
상품 한눈에 보기
Prostate Specific Acid Phosphatase(ACPP)를 인식하는 Rabbit Polyclonal Antibody. Western blot 및 IHC(Paraffin)에 적합. 합성 펩타이드 면역원 사용, 친화 크로마토그래피 정제. 장기 보관 시 -20°C에서 보관 권장.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 01:54
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA5113743 Prostate Specific Acid Phosphatase Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
680,400원VAT 포함 748,440원
Thermo Fisher Scientific · Thermo Fisher Scientific Prostate Specific Acid Phosphatase Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.2–1 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:100 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the middle region of human ACPP |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity chromatography |
| Storage buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping conditions | Wet ice |
| RRID | AB_2884258 |
Product Specific Information
- Immunogen sequence: CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV
- Storage recommendation:
- Short term: 2–8°C up to 1 week
- Long term: -20°C in small aliquots to prevent freeze-thaw cycles
- Predicted homology:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Target Information
ACPP (Prostate Specific Acid Phosphatase)는 orthophosphoric monoester를 alcohol과 orthophosphate로 전환하는 효소입니다. 안드로겐 조절 하에 합성되며, 전립선 상피세포에서 분비됩니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
