Thermo Fisher Scientific Prostate Specific Acid Phosphatase Polyclonal Antibody
상품 한눈에 보기
Prostate Specific Acid Phosphatase(ACPP)를 인식하는 Rabbit Polyclonal Antibody. Western blot 및 IHC(Paraffin)에 적합. 합성 펩타이드 면역원 사용, 친화 크로마토그래피 정제. 장기 보관 시 -20°C에서 보관 권장.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.2–1 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:100 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the middle region of human ACPP |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity chromatography |
| Storage buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping conditions | Wet ice |
| RRID | AB_2884258 |
Product Specific Information
- Immunogen sequence: CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV
- Storage recommendation:
- Short term: 2–8°C up to 1 week
- Long term: -20°C in small aliquots to prevent freeze-thaw cycles
- Predicted homology:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Target Information
ACPP (Prostate Specific Acid Phosphatase)는 orthophosphoric monoester를 alcohol과 orthophosphate로 전환하는 효소입니다. 안드로겐 조절 하에 합성되며, 전립선 상피세포에서 분비됩니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific KIR2DL4 Polyclonal Antibody
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific SIGLEC6 Polyclonal Antibody
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific Prostate Specific Acid Phosphatase Polyclonal Antibody
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific CYP4A22 Polyclonal Antibody
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific PON3 Polyclonal Antibody
680,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.