
Atlas Antibodies Anti-PIH1D3 Antibody
상품 한눈에 보기
인체 PIH1D3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 단백질 발현 검증에 적합합니다. RNA-seq 데이터와의 직교 검증으로 신뢰성 향상. PrEST 항원으로 친화 정제되었으며, 글리세롤 기반 완충액에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PIH1D3 Antibody
PIH1 domain containing 3
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human PIH1D3.
Alternative Gene Names
CXorf41, MGC35261, NYSAR97
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | PIH1 domain containing 3 |
| Target Gene | PIH1D3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPP |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Interspecies Identity | Mouse ENSMUSG00000042433 (55%), Rat ENSRNOG00000054900 (52%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PIH1D1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PIGZ Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PIH1D3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PIK3AP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PIGY Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.