Atlas Antibodies Anti-PICALM Antibody
상품 한눈에 보기
인간 PICALM 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC에 적합하며 RNA-seq 데이터 기반 정교한 정합 검증 완료. 인간, 마우스, 랫트 반응성 확인. PrEST 항원을 이용해 친화 정제된 고품질 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PICALM Antibody
phosphatidylinositol binding clathrin assembly protein
Recommended Applications
- IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human PICALM.
Alternative Gene Names
CALM, CLTH
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phosphatidylinositol binding clathrin assembly protein |
| Target Gene | PICALM |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLA |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일성 |
|---|---|---|
| Mouse | ENSMUSG00000039361 | 93% |
| Rat | ENSRNOG00000018322 | 88% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-PIAS3 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PIAS4 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PICALM Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PICK1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PICK1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.