
Atlas Antibodies Anti-PHYH Antibody
상품 한눈에 보기
Human PHYH 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인간 및 생쥐에서 반응성이 검증되었습니다. 단백질 발현 검증을 위해 독립 항체 비교 검증이 수행되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PHYH Antibody
phytanoyl-CoA 2-hydroxylase
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Independent Validation)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human PHYH
Alternative Gene Names
PAHX, PHYH1, RD
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phytanoyl-CoA 2-hydroxylase |
| Target Gene | PHYH |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRA |
| Verified Species Reactivity | Human, Mouse |
| Interspecies Identity | Mouse ENSMUSG00000026664 (76%), Rat ENSRNOG00000018044 (73%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PHYHD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PHYHIP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PHYH Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PHPT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PHRF1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.