CacheBy
Atlas Antibodies Anti-PHYH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PHYH Antibody

상품 한눈에 보기

Human PHYH 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인간 및 생쥐에서 반응성이 검증되었습니다. 단백질 발현 검증을 위해 독립 항체 비교 검증이 수행되었습니다.

카탈로그번호
HPA011796-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011796-100 Anti-PHYH Antibody, phytanoyl-CoA 2-hydroxylase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011796-25 Anti-PHYH Antibody, phytanoyl-CoA 2-hydroxylase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PHYH Antibody

Anti-PHYH Antibody

phytanoyl-CoA 2-hydroxylase

  • Immunohistochemistry (IHC)
  • Western Blot (WB, Independent Validation)

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human PHYH

Alternative Gene Names

PAHX, PHYH1, RD

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein phytanoyl-CoA 2-hydroxylase
Target Gene PHYH
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRA
Verified Species Reactivity Human, Mouse
Interspecies Identity Mouse ENSMUSG00000026664 (76%), Rat ENSRNOG00000018044 (73%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.