Atlas Antibodies Anti-PHLPP1 Antibody
상품 한눈에 보기
인간 PHLPP1 단백질을 인식하는 폴리클로날 항체. Rabbit 유래 IgG로 제작되었으며, Affinity purified 방식 적용. IHC 등 다양한 응용에 적합. 높은 종간 항원 서열 유사성으로 신뢰성 있는 결과 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PHLPP1 Antibody
PH domain and leucine rich repeat protein phosphatase 1
Recommended Applications
면역조직화학(IHC) 등 다양한 연구용 응용에 적합
Product Description
Polyclonal Antibody against Human PHLPP1
Alternative Gene Names
KIAA0606, PHLPP, PLEKHE1, SCOP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | PH domain and leucine rich repeat protein phosphatase 1 |
| Target Gene | PHLPP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000044340 (95%), Rat ENSRNOG00000002821 (94%) |
Antigen Sequence:
SLDRKTLLLKHRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHKGGGVVKVLGQ
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하세요.
- 각 응용에 맞는 최적 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-PHLPP2 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PHLPP2 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PHLPP1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PHLDB1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PHOSPHO1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.