AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PGAP3 Antibody
상품 한눈에 보기
Human PGAP3 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, Rabbit 유래 IgG 형태로 고순도 정제됨. Affinity purification 방식으로 높은 특이성과 재현성 제공.
- 카탈로그번호
- HPA016591-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA016591-100 Anti-PGAP3 Antibody, post-GPI attachment to proteins 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016591-25 Anti-PGAP3 Antibody, post-GPI attachment to proteins 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PGAP3 Antibody
Anti-PGAP3 Antibody
Target Information
- Target Protein: post-GPI attachment to proteins 3
- Target Gene: PGAP3
- Alternative Gene Names: CAB2, MGC9753, PER1, PERLD1, PP1498
Product Description
Polyclonal antibody against human PGAP3.
Recommended for use in immunohistochemistry (IHC) and immunocytochemistry (ICC).
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000038208 | 92% |
| Rat | ENSRNOG00000046143 | 91% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
- Material Safety Data Sheet (MSDS)
- Open Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.