
Atlas Antibodies Anti-PGAP3 Antibody
상품 한눈에 보기
Human PGAP3 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, Rabbit 유래 IgG 형태로 고순도 정제됨. Affinity purification 방식으로 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PGAP3 Antibody
Target Information
- Target Protein: post-GPI attachment to proteins 3
- Target Gene: PGAP3
- Alternative Gene Names: CAB2, MGC9753, PER1, PERLD1, PP1498
Product Description
Polyclonal antibody against human PGAP3.
Recommended for use in immunohistochemistry (IHC) and immunocytochemistry (ICC).
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000038208 | 92% |
| Rat | ENSRNOG00000046143 | 91% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
- Material Safety Data Sheet (MSDS)
- Open Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PGBD5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PGBD4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PGAP3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PGBD4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PGBD2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.