CacheBy
Atlas Antibodies Anti-PFKFB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PFKFB2 Antibody

상품 한눈에 보기

Human PFKFB2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도와 높은 특이성을 제공합니다. Human에 반응하며 Rat, Mouse와도 높은 서열 유사성을 가집니다.

카탈로그번호
HPA049975-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049975-100 Anti-PFKFB2 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049975-25 Anti-PFKFB2 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PFKFB2 Antibody

Anti-PFKFB2 Antibody

Target: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 (PFKFB2)

  • IHC (Immunohistochemistry)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human PFKFB2.

Open Datasheet

Target Information

항목 내용
Target Protein 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
Target Gene PFKFB2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence RDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEG
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000004162 (95%), Mouse ENSMUSG00000026409 (95%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 확인해야 합니다.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.