
1 / 2
Atlas Antibodies Anti-PFKFB2 Antibody
상품 한눈에 보기
Human PFKFB2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도와 높은 특이성을 제공합니다. Human에 반응하며 Rat, Mouse와도 높은 서열 유사성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PFKFB2 Antibody
Target: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 (PFKFB2)
Recommended Applications
- IHC (Immunohistochemistry)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human PFKFB2.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 |
| Target Gene | PFKFB2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEG |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000004162 (95%), Mouse ENSMUSG00000026409 (95%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 확인해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PFKFB3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PFKFB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PFKFB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PFDN4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PFDN5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.