CacheBy
Atlas Antibodies Anti-PFKFB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PFKFB2 Antibody

상품 한눈에 보기

Human PFKFB2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도와 높은 특이성을 제공합니다. Human에 반응하며 Rat, Mouse와도 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049975-100 Anti-PFKFB2 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049975-25 Anti-PFKFB2 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PFKFB2 Antibody

Anti-PFKFB2 Antibody

Target: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 (PFKFB2)

  • IHC (Immunohistochemistry)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human PFKFB2.

Open Datasheet

Target Information

항목 내용
Target Protein 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
Target Gene PFKFB2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence RDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEG
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000004162 (95%), Mouse ENSMUSG00000026409 (95%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 확인해야 합니다.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.