
Atlas Antibodies Anti-PDXK Antibody
상품 한눈에 보기
Human PDXK 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Independent validation으로 신뢰성 검증. 40% glycerol 기반 완충액에 보존되어 있으며, PrEST 항원으로 친화 정제됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PDXK Antibody
Target Protein: pyridoxal (pyridoxine, vitamin B6) kinase
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): RNA-seq 데이터와 비교하여 고·저 발현 조직 간 단백질 발현 검증
- WB (Independent validation): 서로 다른 에피토프를 인식하는 항체 간 단백질 발현 비교 검증
- ICC: 세포 수준의 단백질 발현 분석에 사용 가능
Product Description
Polyclonal antibody against human PDXK.
Alternative Gene Names
C21orf124, C21orf97, FLJ21324, FLJ31940, MGC15873, PKH, PNK, PRED79
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | pyridoxal (pyridoxine, vitamin B6) kinase |
| Target Gene | PDXK |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQ |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Mouse ENSMUSG00000032788 (88%), Rat ENSRNOG00000049937 (86%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PDXDC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDXDC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDXK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDXDC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDSS1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.