
Atlas Antibodies Anti-PDGFD Antibody
상품 한눈에 보기
인간 PDGFD 단백질을 인식하는 토끼 폴리클로날 항체입니다. PrEST 항원을 이용해 친화 정제되었으며, 면역형광 등 다양한 응용에 적합합니다. 40% 글리세롤 기반 PBS 버퍼에 보존제가 포함되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PDGFD Antibody
Target: Platelet Derived Growth Factor D (PDGFD)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human PDGFD.
Alternative gene names: IEGF, MSTP036, SCDGF-B.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASETNWESVTSSISGV
Recommended Applications
- ICC (Immunocytochemistry)
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Platelet derived growth factor D |
| Target Gene | PDGFD |
| Verified Species Reactivity | Human |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Notes | Gently mix before use. Determine optimal concentration and conditions experimentally. |
| MSDS | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PDGFRL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDHA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDGFD Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDGFC Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDGFD Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.