
Atlas Antibodies Anti-PDE4DIP Antibody
인간 PDE4DIP 단백질을 표적으로 하는 토끼 폴리클로날 항체. WB 실험에 적합하며 RNA-seq 데이터 기반의 orthogonal validation 완료. 인간, 마우스, 랫트 반응성 검증. PrEST 항원으로 친화 정제된 고품질 항체.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PDE4DIP Antibody
Target Protein: phosphodiesterase 4D interacting protein (PDE4DIP)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using Western Blot (WB) by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against human PDE4DIP.
Alternative Gene Names
CMYA2, KIAA0454, KIAA0477, MMGL
Antigen Information
Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
DVLSSNEATMQSMESLLRAKGLEVEQLSTTCQNLQWLKEEMETKFSRWQKEQESIIQQLQTSLHDRNKEVEDLSATLLCKLGPGQSEIAEELCQRLQRKERMLQDLLSDRNKQVLEHEMEIQGLLQSVSTREQESQAAA
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000038170 | 90% |
| Rat | ENSRNOG00000018220 | 87% |
Antibody Specifications
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PDE6B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDE6B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDE4DIP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDE6A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDE6A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|