
Atlas Antibodies Anti-PDE3A Antibody
상품 한눈에 보기
Human PDE3A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합. Orthogonal validation을 통해 단백질 발현 검증. 고순도의 Affinity purified 항체로 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PDE3A Antibody
phosphodiesterase 3A, cGMP-inhibited
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Orthogonal validation)
- ICC (Immunocytochemistry)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human PDE3A
Alternative Gene Names
- CGI-PDE
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phosphodiesterase 3A, cGMP-inhibited |
| Target Gene | PDE3A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNEDETECLREPLRKASACSTYAPETMMFLDKPILAPEPLVMDNLDSIMEQLNT |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000025042 (82%), Mouse ENSMUSG00000041741 (81%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PDE4B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDE4A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDE3A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDE2A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDE3A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.