Atlas Antibodies Anti-PDCD5 Antibody

상품 한눈에 보기

인간 PDCD5 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생성됨. IHC 및 ICC 등 다양한 응용에 적합하며, RNA-seq 데이터와 비교한 정교한 Orthogonal Validation 수행. 친화 정제된 고순도 항체로 신뢰성 높은 단백질 발현 분석에 활용 가능.

카탈로그번호: HPA018471-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA018471-100 Anti-PDCD5 Antibody, programmed cell death 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA018471-25 Anti-PDCD5 Antibody, programmed cell death 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PDCD5 Antibody

Anti-PDCD5 Antibody

programmed cell death 5

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human PDCD5

Alternative Gene Names

MGC9294, TFAR19

Open Datasheet

Target Information

항목	내용
Target Protein	programmed cell death 5
Target Gene	PDCD5
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000030417 (97%)
Rat ENSRNOG00000050827 (97%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand