AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PDCD1LG2 Antibody
상품 한눈에 보기
Human PDCD1LG2 단백질을 인식하는 토끼 유래 polyclonal antibody. IHC 및 ICC에 적합하며, PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성 확보. PD-L2 연구 및 면역 관련 단백질 분석에 활용 가능.
- 카탈로그번호
- HPA013411-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA013411-100 Anti-PDCD1LG2 Antibody, programmed cell death 1 ligand 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013411-25 Anti-PDCD1LG2 Antibody, programmed cell death 1 ligand 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PDCD1LG2 Antibody
Anti-PDCD1LG2 Antibody
Target: programmed cell death 1 ligand 2 (PD-L2)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human PDCD1LG2 (programmed cell death 1 ligand 2).
Alternative Gene Names
B7-DC, bA574F11.2, Btdc, CD273, PD-L2, PDL2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | programmed cell death 1 ligand 2 |
| Target Gene | PDCD1LG2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPT |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000016498 | 77% |
| Rat | ENSRNOG00000016136 | 77% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.