AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PDCD2 Antibody
상품 한눈에 보기
인간 PDCD2 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 WB 분석에 적합하며, Human, Mouse, Rat에서 반응성이 검증되었습니다. PrEST 항원을 이용해 친화 정제되었으며, 안정화된 PBS 버퍼에 보존됩니다.
- 카탈로그번호
- HPA075534-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA075534-100 Anti-PDCD2 Antibody, programmed cell death 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075534-25 Anti-PDCD2 Antibody, programmed cell death 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PDCD2 Antibody
Anti-PDCD2 Antibody
Target: programmed cell death 2 (PDCD2)
Supplier: Atlas Antibodies
Type: Polyclonal Antibody against Human PDCD2
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody raised in rabbit against human PDCD2 protein.
Alternative Gene Names
- RP8
- ZMYND7
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | programmed cell death 2 |
| Target Gene | PDCD2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PEQILRYGRGIAPIWISGENIPQEKDIPDCPCGAKRILEFQVMPQLLNYLKADRLGKSIDWGILAVFTCAESCSLGTGYTEEFVWKQDVTDTP |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000014771 | 94% |
| Rat | ENSRNOG00000001490 | 91% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.