CacheBy
Atlas Antibodies Anti-PDCD4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PDCD4 Antibody

상품 한눈에 보기

Human PDCD4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. RNA-seq 데이터 기반 Orthogonal 검증 완료. Human, Mouse, Rat 반응성 확인. PrEST 항원을 이용한 Affinity 정제 제품.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA001032-100 Anti-PDCD4 Antibody, programmed cell death 4 (neoplastic transformation inhibitor) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001032-25 Anti-PDCD4 Antibody, programmed cell death 4 (neoplastic transformation inhibitor) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PDCD4 Antibody

Anti-PDCD4 Antibody

Target: programmed cell death 4 (neoplastic transformation inhibitor)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation)
  • WB (Western Blot)

Orthogonal validation:
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human PDCD4


Alternative Gene Names

  • H731

Open Datasheet


Target Information

항목 내용
Target Protein programmed cell death 4 (neoplastic transformation inhibitor)
Target Gene PDCD4
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence VMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKE

Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000014779 (98%)
  • Mouse ENSMUSG00000024975 (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.