CacheBy
Atlas Antibodies Anti-PDCD4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PDCD4 Antibody

상품 한눈에 보기

Human PDCD4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. RNA-seq 데이터 기반 Orthogonal 검증 완료. Human, Mouse, Rat 반응성 확인. PrEST 항원을 이용한 Affinity 정제 제품.

카탈로그번호
HPA001032-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001032-100 Anti-PDCD4 Antibody, programmed cell death 4 (neoplastic transformation inhibitor) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001032-25 Anti-PDCD4 Antibody, programmed cell death 4 (neoplastic transformation inhibitor) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PDCD4 Antibody

Anti-PDCD4 Antibody

Target: programmed cell death 4 (neoplastic transformation inhibitor)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation)
  • WB (Western Blot)

Orthogonal validation:
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human PDCD4


Alternative Gene Names

  • H731

Open Datasheet


Target Information

항목 내용
Target Protein programmed cell death 4 (neoplastic transformation inhibitor)
Target Gene PDCD4
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence VMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKE

Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000014779 (98%)
  • Mouse ENSMUSG00000024975 (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.