Atlas Antibodies Anti-PDCD10 Antibody

상품 한눈에 보기

Human PDCD10 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 연구용으로 적합. CCM3/TFAR15 유전자 대체명으로 알려짐. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human에 반응하며 Mouse, Rat과 높은 서열 유사성 보유.

카탈로그번호: HPA027095-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027095-100 Anti-PDCD10 Antibody, programmed cell death 10 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027095-25 Anti-PDCD10 Antibody, programmed cell death 10 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PDCD10 Antibody

Anti-PDCD10 Antibody

Target Protein: programmed cell death 10 (PDCD10)
Alternative Gene Names: CCM3, TFAR15

Recommended Applications

Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human PDCD10, also known as programmed cell death 10. This antibody is affinity purified using the PrEST antigen as the affinity ligand.

Open Datasheet (PDF)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMK

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000027835	100%
Rat	ENSRNOG00000010147	92%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.