
원본
Thermo Fisher Scientific Fibrinogen alpha chain Polyclonal Antibody
상품 한눈에 보기
Fibrinogen α-chain을 인식하는 Rabbit Polyclonal Antibody로 인간 및 랫트 시료에 반응. Western blot에 적합하며, 고순도 친화 크로마토그래피로 정제. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도. 혈액응고 연구용으로 적합.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 12:43
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA5114364 Fibrinogen alpha chain Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
646,200원VAT 포함 710,820원
Thermo Fisher Scientific · Thermo Fisher Scientific Fibrinogen alpha chain Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to residues 687–727 of human FGA (RTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRGSVLRVE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C short term; for long term, store at -20°C. Avoid freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2884821 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Fibrinogen is a soluble plasma protein synthesized by the liver. It is a hexamer composed of two sets of disulfide-linked chains and serves as the precursor of fibrin, essential for blood coagulation. Conversion to fibrin occurs via thrombin in the presence of calcium ions.
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
