
Thermo Fisher Scientific Fibrinogen alpha chain Polyclonal Antibody
Fibrinogen α-chain을 인식하는 Rabbit Polyclonal Antibody로 인간 및 랫트 시료에 반응. Western blot에 적합하며, 고순도 친화 크로마토그래피로 정제. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도. 혈액응고 연구용으로 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to residues 687–727 of human FGA (RTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRGSVLRVE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C short term; for long term, store at -20°C. Avoid freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2884821 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Fibrinogen is a soluble plasma protein synthesized by the liver. It is a hexamer composed of two sets of disulfide-linked chains and serves as the precursor of fibrin, essential for blood coagulation. Conversion to fibrin occurs via thrombin in the presence of calcium ions.
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific USP29 Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific Nkx2.1 Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific Fibrinogen alpha chain Polyclonal Antibody
646,200원

Thermo Fisher Scientific
Thermo Fisher Scientific SLC12A9 Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific WDR70 Polyclonal Antibody
680,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|