Thermo Fisher Scientific PAGE4 Polyclonal Antibody
PAGE4 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 적합합니다. 인간 유래 단백질에 반응하며, N-말단 펩타이드(aa 14-63)를 면역원으로 사용했습니다. 액상 형태로 제공되며, -20°C에서 보관합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific PAGE4 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the N-terminal of human PAGE4 (aa 14–63) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2610144 |
Product Specific Information
Peptide sequence:
DGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDC
Sequence homology:
Human: 100%
Target Information
This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer. It is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins and belongs to a family of CT (cancer-testis) antigens. The protein may play a role in benign and malignant prostate diseases. A related pseudogene is located on chromosome 7.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.