CacheBy
Atlas Antibodies Anti-C2orf42 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C2orf42 Antibody

상품 한눈에 보기

Human C2orf42 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 상동성을 보입니다. 40% 글리세롤/PBS 완충액에 보존되어 있습니다.

카탈로그번호
HPA031840-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031840-100 Anti-C2orf42 Antibody, chromosome 2 open reading frame 42 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031840-25 Anti-C2orf42 Antibody, chromosome 2 open reading frame 42 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C2orf42 Antibody

Anti-C2orf42 Antibody

Target: chromosome 2 open reading frame 42 (C2orf42)
Type: Polyclonal Antibody against Human C2orf42
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody specifically detects the human C2orf42 protein. It is affinity purified using the PrEST antigen as the affinity ligand.


Alternative Gene Names

  • FLJ20558

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 2 open reading frame 42
Target Gene C2orf42
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence IHQTMHYQFDGKPEPLVFHIPQSFFDALQQRISIGSAKKRLPNSTTAFVRKDALPLGTFSKYTWHITNILQVKQILDTPEMPLEITRSFIQNRDGTY

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 일치율
Mouse ENSMUSG00000046679 100%
Rat ENSRNOG00000017380 98%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.