CacheBy
Atlas Antibodies Anti-C22orf31 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C22orf31 Antibody

상품 한눈에 보기

인체 C22orf31 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 WB(재조합 발현) 검증 완료. 토끼 유래 IgG 형식으로 높은 특이성과 재현성 제공. PrEST 항원 기반 친화 정제 방식으로 생산됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068522-100 Anti-C22orf31 Antibody, chromosome 22 open reading frame 31 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068522-25 Anti-C22orf31 Antibody, chromosome 22 open reading frame 31 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C22orf31 Antibody

Anti-C22orf31 Antibody

Target: chromosome 22 open reading frame 31
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against human C22orf31.


Alternative Gene Names

bK747E2.1, HS747E2A

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 22 open reading frame 31
Target Gene C22orf31
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000027230 (25%), Mouse ENSMUSG00000040463 (21%)

Antigen Sequence

LTVRQDLEDRYAEHVAATQALPQDSGTAAWKGRVLLPETQKRQQLSEDTLTIHGLPTEGYQALYHAVVEPMLWNPSGTPKRYSLELGKAIKQKLWEALCSQGAISEGAQRDRFPGRKQPGVHEEPVLKKWPKLKSK


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.