
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C1orf87 Antibody
상품 한눈에 보기
인체 C1orf87 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 RNA-seq 비교를 통한 정교한 오쏘고날 검증 완료. 토끼 유래 IgG, PrEST 항원으로 친화 정제. 인체 반응성 검증 및 안정적 PBS/glycerol 버퍼 구성.
- 카탈로그번호
- HPA031368-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031368-100 Anti-C1orf87 Antibody, chromosome 1 open reading frame 87 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031368-25 Anti-C1orf87 Antibody, chromosome 1 open reading frame 87 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C1orf87 Antibody
Anti-C1orf87 Antibody
Target: Chromosome 1 open reading frame 87 (C1orf87)
Type: Polyclonal Antibody against Human C1orf87
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Alternative Gene Names
- CREF
- MGC34837
Product Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Chromosome 1 open reading frame 87 |
| Target Gene | C1orf87 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000078639 (69%), Rat ENSRNOG00000026169 (67%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
Antigen Sequence
ALRTTNGRLNIDNLNLSFRKEDRSFSGCLPLPKVRAICGKHGLYLTLSLLETLLNHQDLGYQNEIKWQNFVEMLTRASSDLLSDLPTGKNEKK제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



