CacheBy
Atlas Antibodies Anti-C1orf87 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf87 Antibody

상품 한눈에 보기

인체 C1orf87 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 RNA-seq 비교를 통한 정교한 오쏘고날 검증 완료. 토끼 유래 IgG, PrEST 항원으로 친화 정제. 인체 반응성 검증 및 안정적 PBS/glycerol 버퍼 구성.

카탈로그번호
HPA031368-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031368-100 Anti-C1orf87 Antibody, chromosome 1 open reading frame 87 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031368-25 Anti-C1orf87 Antibody, chromosome 1 open reading frame 87 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf87 Antibody

Anti-C1orf87 Antibody

Target: Chromosome 1 open reading frame 87 (C1orf87)
Type: Polyclonal Antibody against Human C1orf87
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Alternative Gene Names

  • CREF
  • MGC34837

Open Datasheet (PDF)


Product Specifications

항목 내용
Target Protein Chromosome 1 open reading frame 87
Target Gene C1orf87
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000078639 (69%), Rat ENSRNOG00000026169 (67%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

Antigen Sequence

ALRTTNGRLNIDNLNLSFRKEDRSFSGCLPLPKVRAICGKHGLYLTLSLLETLLNHQDLGYQNEIKWQNFVEMLTRASSDLLSDLPTGKNEKK

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.