AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C1orf74 Antibody
상품 한눈에 보기
Human C1orf74 단백질을 타깃으로 하는 폴리클로날 항체. Rabbit 유래 IgG 형식으로 제작되어 IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human에 대해 검증된 반응성 보유.
- 카탈로그번호
- HPA028496-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028496-100 Anti-C1orf74 Antibody, chromosome 1 open reading frame 74 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028496-25 Anti-C1orf74 Antibody, chromosome 1 open reading frame 74 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C1orf74 Antibody
Anti-C1orf74 Antibody
Target: chromosome 1 open reading frame 74 (C1orf74)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C1orf74.
Alternative Gene Names
- FLJ25078
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 1 open reading frame 74 |
| Target Gene | C1orf74 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LLGYPVPYTFHLNQGDDNCLALTPLRVFTARISWLLGQPPILLYSFSVPESLFPGLRDILNTWEKDLRTRFRTQNDFADL |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 동일도 |
|---|---|---|
| Mouse | ENSMUSG00000079144 | 79% |
| Rat | ENSRNOG00000005558 | 76% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.