Atlas Antibodies Anti-C1orf68 Antibody

상품 한눈에 보기

인간 C1orf68 단백질에 특이적인 폴리클로날 항체로, IHC를 통한 단백질 발현 정량에 적합합니다. Rabbit 호스트에서 생산되었으며 PrEST 항원을 이용해 친화 정제되었습니다. RNA-seq 데이터 기반 정교한 Orthogonal 검증 완료. 인간 시료에 최적화되어 있습니다.

카탈로그번호: HPA057942-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA057942-100 Anti-C1orf68 Antibody, chromosome 1 open reading frame 68 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA057942-25 Anti-C1orf68 Antibody, chromosome 1 open reading frame 68 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C1orf68 Antibody

Anti-C1orf68 Antibody

Target: chromosome 1 open reading frame 68 (C1orf68)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human C1orf68.

Alternative Gene Names

LEP7

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	chromosome 1 open reading frame 68
Target Gene	C1orf68
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	PCSTSYCCLAPRTFGVSPLRRWIQRPQNCNTGSSGCCENSGSSGCCGSGGCGCSCGCGSSG
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000090314 (77%), Rat ENSRNOG00000023511 (71%)