CacheBy
Atlas Antibodies Anti-C1orf64 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf64 Antibody

상품 한눈에 보기

인간 C1orf64 단백질을 타겟으로 하는 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증에 적합. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간에 특이적으로 반응하며, 안정적인 PBS/glycerol 버퍼에 보존됨.

카탈로그번호
HPA026676-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026676-100 Anti-C1orf64 Antibody, chromosome 1 open reading frame 64 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026676-25 Anti-C1orf64 Antibody, chromosome 1 open reading frame 64 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf64 Antibody

Anti-C1orf64 Antibody

Target: chromosome 1 open reading frame 64
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against human C1orf64.


Alternative Gene Names

  • ERRF
  • MGC24047

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 1 open reading frame 64
Target Gene C1orf64
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (42%), Rat (30%)

Antigen Sequence:

HLTRVTPMGGGCLAQARATLPLCRGSVASASFPVSPLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKALSSCVCGQ

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.