CacheBy
Atlas Antibodies Anti-C1orf68 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf68 Antibody

상품 한눈에 보기

인체 C1orf68 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 및 RNA-seq 기반 Orthogonal 검증 수행. PrEST 항원으로 친화 정제된 고품질 항체로 인간 시료에 반응. 안정적 PBS/glycerol 버퍼에 보존.

카탈로그번호
HPA040836-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040836-100 Anti-C1orf68 Antibody, chromosome 1 open reading frame 68 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040836-25 Anti-C1orf68 Antibody, chromosome 1 open reading frame 68 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf68 Antibody

Anti-C1orf68 Antibody

Target: Chromosome 1 open reading frame 68 (C1orf68)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human C1orf68.


Alternative Gene Names

  • LEP7

Target Information

항목 내용
Target Protein Chromosome 1 open reading frame 68
Target Gene C1orf68
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000090314 (77%)
Rat ENSRNOG00000023511 (71%)

Antigen Sequence

PCSTSYCCLAPRTFGVSPLRRWIQRPQNCNTGSSGCCENSGSSGCCGSGGCGCSCGCGSSG

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.