
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C1orf210 Antibody
상품 한눈에 보기
Human C1orf210 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. 인간에 반응하며 마우스 및 랫과 높은 서열 유사성 보유.
- 카탈로그번호
- HPA013788-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA013788-100 Anti-C1orf210 Antibody, chromosome 1 open reading frame 210 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013788-25 Anti-C1orf210 Antibody, chromosome 1 open reading frame 210 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C1orf210 Antibody
Anti-C1orf210 Antibody
Target: chromosome 1 open reading frame 210 (C1orf210)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human C1orf210.
Alternative Gene Names
- MGC52423
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 1 open reading frame 210 |
| Target Gene | C1orf210 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RYHASYRHRPLPETGRGGRPQVAEDEDDDGFIEDNYIQPGTGELGTEGSRDHF |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000028536 (79%) Rat ENSRNOG00000020259 (77%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative). Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



