
Atlas Antibodies Anti-C1GALT1 Antibody
상품 한눈에 보기
인간 C1GALT1 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합. Rabbit 유래 IgG로 고순도 정제됨. 인간에 대한 반응성이 확인되었으며, 다른 종과 높은 서열 유사성 보유. 안정적인 PBS/glycerol 버퍼에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C1GALT1 Antibody
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human C1GALT1.
Alternative Gene Names
C1GALT, T-synthase
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 |
| Target Gene | C1GALT1 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Antigen Sequence:
VDTQPNVLHNDPHARHSDDNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIK
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Reactivity | Human |
| Mouse Ortholog | ENSMUSG00000042460 (88%) |
| Rat Ortholog | ENSRNOG00000007804 (88%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 항목 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C1GALT1C1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1GALT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1GALT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1D Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C19orf81 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.