CacheBy
Atlas Antibodies Anti-C1GALT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1GALT1 Antibody

상품 한눈에 보기

인간 C1GALT1 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합. Rabbit 유래 IgG로 고순도 정제됨. 인간에 대한 반응성이 확인되었으며, 다른 종과 높은 서열 유사성 보유. 안정적인 PBS/glycerol 버퍼에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA011294-100 Anti-C1GALT1 Antibody, core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011294-25 Anti-C1GALT1 Antibody, core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1GALT1 Antibody

Anti-C1GALT1 Antibody

core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1


Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human C1GALT1.


Alternative Gene Names

C1GALT, T-synthase

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
Target Gene C1GALT1
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Antigen Sequence:
VDTQPNVLHNDPHARHSDDNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIK


Species Reactivity

항목 내용
Verified Reactivity Human
Mouse Ortholog ENSMUSG00000042460 (88%)
Rat Ortholog ENSRNOG00000007804 (88%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

항목 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.