
Atlas Antibodies Anti-C15orf57 Antibody
상품 한눈에 보기
Human C15orf57 단백질을 인식하는 토끼 다클론 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며, 라트와 마우스에서도 높은 서열 유사성을 보임. PBS 기반 완충액과 글리세롤로 안정화됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C15orf57 Antibody
Target: chromosome 15 open reading frame 57 (C15orf57)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C15orf57.
Alternative Gene Names
- CCDC32
- MGC20481
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 15 open reading frame 57 |
| Target Gene | C15orf57 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | GSGLRFQMKMFESADSTATRSGQDLWAEICSCLPNPEQEDGANNAFSDSFVDSCPEGEGQREVADFAVQPAVKPWAPLQDSEVYLASLEKKL |
Species Reactivity
- Verified: Human
- Ortholog Identity:
- Rat ENSRNOG00000010472 (74%)
- Mouse ENSMUSG00000039983 (71%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C16orf58 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C16orf46 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C15orf57 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C15orf59 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C15orf65 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.