CacheBy
Atlas Antibodies Anti-C11orf58 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C11orf58 Antibody

상품 한눈에 보기

Human C11orf58 단백질을 인식하는 rabbit polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 가짐. 40% glycerol 및 PBS buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA036591-100 Anti-C11orf58 Antibody, chromosome 11 open reading frame 58 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036591-25 Anti-C11orf58 Antibody, chromosome 11 open reading frame 58 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf58 Antibody

Anti-C11orf58 Antibody

Target: chromosome 11 open reading frame 58 (C11orf58)
Alternative Gene Name: SMAP

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C11orf58.

Target Information

항목 내용
Target Protein chromosome 11 open reading frame 58
Target Gene C11orf58
Alternative Gene Name SMAP
Verified Species Reactivity Human
Interspecies Identity Mouse (98%), Rat (98%)

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence INEELESQYQQSMDSKLSGRYRRHCGLGFSEVEDHDGEGDVAGDDDDDD

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol, PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.