CacheBy
Atlas Antibodies Anti-C11orf58 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C11orf58 Antibody

상품 한눈에 보기

인간 C11orf58 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 높은 종간 반응성(인간, 생쥐, 랫트 98%)을 보유. 안정적 PBS/glycerol 버퍼에 보존.

카탈로그번호
HPA076406-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA076406-100 Anti-C11orf58 Antibody, chromosome 11 open reading frame 58 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076406-25 Anti-C11orf58 Antibody, chromosome 11 open reading frame 58 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf58 Antibody

Anti-C11orf58 Antibody

Target Information

  • Target Protein: Chromosome 11 open reading frame 58
  • Target Gene: C11orf58
  • Alternative Gene Names: SMAP

Product Description

Polyclonal antibody against human C11orf58.

  • Immunohistochemistry (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

INEELESQYQQSMDSKLSGRYRRHCGLGFSEVEDHDGEGDVAGDDDDDD

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000053659 (98%)
  • Mouse ENSMUSG00000030663 (98%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.