CacheBy
Atlas Antibodies Anti-C11orf53 Antibody
원본

Atlas Antibodies Anti-C11orf53 Antibody

상품 한눈에 보기

인간 C11orf53 단백질을 인식하는 토끼 폴리클로날 항체로, 면역조직화학 등 다양한 연구 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 40% 글리세롤/PBS 완충액에 보존되어 안정성이 우수합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA056128-100 Anti-C11orf53 Antibody, chromosome 11 open reading frame 53 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056128-25 Anti-C11orf53 Antibody, chromosome 11 open reading frame 53 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf53 Antibody

Anti-C11orf53 Antibody

Target: chromosome 11 open reading frame 53 (C11orf53)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C11orf53.


Alternative Gene Names

  • MGC50104

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 11 open reading frame 53
Target Gene C11orf53
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence STSCLSQLESGSIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSNDLPPKV

Verified Species Reactivity

  • Human

Interspecies Information

종 Ortholog ID 항원 서열 유사도
Rat ENSRNOG00000012022 88%
Mouse ENSMUSG00000036027 88%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.