CacheBy
Atlas Antibodies Anti-C11orf57 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C11orf57 Antibody

상품 한눈에 보기

Human C11orf57 단백질을 인식하는 rabbit polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, mouse 및 rat과 90% 서열 유사성 보유. 안정한 PBS/glycerol buffer에 보존.

카탈로그번호
HPA039892-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039892-100 Anti-C11orf57 Antibody, chromosome 11 open reading frame 57 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039892-25 Anti-C11orf57 Antibody, chromosome 11 open reading frame 57 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf57 Antibody

Anti-C11orf57 Antibody

Target: chromosome 11 open reading frame 57 (C11orf57)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human C11orf57.


Alternative Gene Names

  • FLJ10726

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 11 open reading frame 57
Target Gene C11orf57
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MSRIPLGKVLLRNVIRHTDAHNKIQEESDMWKIRELEKQMEDAYRGTKRKMLPSSSSRMRSDGFDEESQRYYWRPKNEIS

Species Reactivity

  • Verified: Human
  • Ortholog Identity: Mouse (ENSMUSG00000059820, 90%), Rat (ENSRNOG00000009958, 90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.