CacheBy
Atlas Antibodies Anti-C10orf88 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C10orf88 Antibody

상품 한눈에 보기

Human C10orf88 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정교한 Orthogonal 검증 제공. Rabbit 유래 IgG 항체이며 PrEST 항원 기반 친화 정제 방식 사용. Human에 대한 높은 특이성과 재현성 확보.

카탈로그번호
HPA039681-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039681-100 Anti-C10orf88 Antibody, chromosome 10 open reading frame 88 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039681-25 Anti-C10orf88 Antibody, chromosome 10 open reading frame 88 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C10orf88 Antibody

Anti-C10orf88 Antibody

Target: chromosome 10 open reading frame 88
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human C10orf88.


Alternative Gene Names

  • Em: AC073585.5
  • FLJ13490

Open Datasheet


Target Information

항목 내용
Target Protein chromosome 10 open reading frame 88
Target Gene C10orf88
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (72%), Rat (68%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

CSQVNHLHVGNKTECQENITKHGERILGVGMEEQSICSYLEKILSKNMELMEKKLMDYIDQRIHELQEHIDDKIALLLDLLQNPNSP

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.