Atlas Antibodies Anti-C10orf53 Antibody

상품 한눈에 보기

Human C10orf53 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. Orthogonal 및 재조합 발현 검증을 통해 높은 특이성과 신뢰성을 제공. 프레스트(PrEST) 항원 친화 정제 방식으로 제조되어 재현성 우수. 다양한 조직 연구에 적합.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기

Atlas Antibodies HPA037951-100 Anti-C10orf53 Antibody, chromosome 10 open reading frame 53 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA037951-25 Anti-C10orf53 Antibody, chromosome 10 open reading frame 53 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C10orf53 Antibody

Anti-C10orf53 Antibody

Target: chromosome 10 open reading frame 53 (C10orf53)
Type: Polyclonal Antibody against Human C10orf53

Recommended Applications

IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저 발현 조직 간의 IHC 검증 수행
WB (Recombinant expression validation): 타깃 단백질 과발현을 이용한 Western blot 검증

Product Description

Polyclonal antibody targeting human C10orf53.
Validated for orthogonal and recombinant expression applications.

Alternative Gene Names

Em: AC069546.1

Open Datasheet

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:

MPKNAVVILRYGPYSAAGLPVEHHTFRLQGLQAVLAIDGHEVILEKIEDWNVVELMVNEEVIFHCNIKDLEF

Species Reactivity

Species	Reactivity	Ortholog ID
Human	Verified	-
Rat	78% identity	ENSRNOG00000039749
Mouse	74% identity	ENSMUSG00000072473

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide
Purification Method	Affinity purified using the PrEST antigen as affinity ligand