CacheBy
Atlas Antibodies Anti-C10orf128 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C10orf128 Antibody

상품 한눈에 보기

Human C10orf128 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산된 IgG 형식입니다. IHC 등 다양한 연구 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA058166-100 Anti-C10orf128 Antibody, chromosome 10 open reading frame 128 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058166-25 Anti-C10orf128 Antibody, chromosome 10 open reading frame 128 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C10orf128 Antibody

Anti-C10orf128 Antibody

Target: Chromosome 10 open reading frame 128 (C10orf128)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C10orf128.


Alternative Gene Names

  • Em:AC084727.5

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Chromosome 10 open reading frame 128
Target Gene C10orf128
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000041707 (60%)
Rat ENSRNOG00000042628 (52%)

Antigen Sequence:
KICMIRRHLFDDDSSDLKSTPGGLSDTIPLKKRAPRAHVLRD


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 요소 내용
Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.