AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C10orf113 Antibody
상품 한눈에 보기
Human C10orf113 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며, 버퍼에 글리세롤과 아지드가 포함됨.
- 카탈로그번호
- HPA037013-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA037013-100 Anti-C10orf113 Antibody, chromosome 10 open reading frame 113 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037013-25 Anti-C10orf113 Antibody, chromosome 10 open reading frame 113 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C10orf113 Antibody
Anti-C10orf113 Antibody
Target: Chromosome 10 open reading frame 113 (C10orf113)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human C10orf113, generated in rabbit. The antibody was affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- bA165O3.1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Chromosome 10 open reading frame 113 |
| Target Gene | C10orf113 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000042912 (32%), Mouse ENSMUSG00000033854 (25%) |
Antigen Sequence
LQSWPTLARWLRRVSFSLYKPPIQAAPEPDPGNWAKSPRLSLGPEGITKGKHGFKFQGIKEKFNVSKKVLKBuffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.