CacheBy
Atlas Antibodies Anti-C10orf35 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C10orf35 Antibody

상품 한눈에 보기

인체 C10orf35 단백질을 인식하는 폴리클로날 항체로, IHC에서 RNA-seq 데이터와 비교하여 단백질 발현을 정교하게 검증합니다. 토끼 유래 IgG이며, 프레스트 항원으로 친화 정제되었습니다. 인간 반응성이 검증되어 연구용으로 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA034591-100 Anti-C10orf35 Antibody, chromosome 10 open reading frame 35 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034591-25 Anti-C10orf35 Antibody, chromosome 10 open reading frame 35 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C10orf35 Antibody

Anti-C10orf35 Antibody

Target: Chromosome 10 open reading frame 35 (C10orf35)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human C10orf35.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Chromosome 10 open reading frame 35
Target Gene C10orf35
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000020083 (40%)
Rat ENSRNOG00000051000 (35%)

Antigen Sequence:
MSPVLSGIHSIYSAWVTSVNITDCKPPSISGAAHQGPTAPGRMVRILANGEIVQDDDPRVRTTTQ


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.