Atlas Antibodies Anti-BUB3 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA003601-100 | - | Atlas Antibodies HPA003601-100 Anti-BUB3 Antibody, BUB3 mitotic checkpoint protein 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA003601-25 | - | Atlas Antibodies HPA003601-25 Anti-BUB3 Antibody, BUB3 mitotic checkpoint protein 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-BUB3 Antibody
BUB3 mitotic checkpoint protein
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human BUB3
Alternative Gene Names
BUB3L
Target Protein
BUB3 mitotic checkpoint protein
Target Gene
BUB3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
YQTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSP
Verified Species Reactivity
Human, Mouse
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000020643 (99%)
Mouse ENSMUSG00000066979 (99%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|