
Atlas Antibodies Anti-BTBD7 Antibody
인간 BTBD7 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. 정제된 토끼 IgG 항체이며, RNA-seq 데이터 기반의 Orthogonal 검증을 거쳤습니다. 40% 글리세롤 PBS 버퍼에 보존되어 안정적입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BTBD7 Antibody
BTB (POZ) domain containing 7
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Orthogonal validation:
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human BTBD7.
Alternative Gene Names
FLJ10648, FUP1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | BTB (POZ) domain containing 7 |
| Target Gene | BTBD7 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000008598 (99%), Mouse ENSMUSG00000041702 (98%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
LLHYLYTGEFGMEDSRFQNVDILVQLSEEFGTPNSLDVDMRGLFDYMCYYDVVLSFSSDSELVEAFGGNQNCLDEELKAHKAVISARSPFFRNLLQRRIRTGEE
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-BTBD3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BTBD7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BTBD7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BTBD19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BTBD6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|