CacheBy
Atlas Antibodies Anti-BTBD7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BTBD7 Antibody

상품 한눈에 보기

인간 BTBD7 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. 정제된 토끼 IgG 항체이며, RNA-seq 데이터 기반의 Orthogonal 검증을 거쳤습니다. 40% 글리세롤 PBS 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA053406-100 Anti-BTBD7 Antibody, BTB (POZ) domain containing 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053406-25 Anti-BTBD7 Antibody, BTB (POZ) domain containing 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BTBD7 Antibody

Anti-BTBD7 Antibody

BTB (POZ) domain containing 7

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Orthogonal validation:
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human BTBD7.

Alternative Gene Names

FLJ10648, FUP1

Open Datasheet

Target Information

항목 내용
Target Protein BTB (POZ) domain containing 7
Target Gene BTBD7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000008598 (99%), Mouse ENSMUSG00000041702 (98%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

LLHYLYTGEFGMEDSRFQNVDILVQLSEEFGTPNSLDVDMRGLFDYMCYYDVVLSFSSDSELVEAFGGNQNCLDEELKAHKAVISARSPFFRNLLQRRIRTGEE

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.