AI 생성

1 / 2

Atlas Antibodies Anti-BSG Antibody

상품 한눈에 보기

인체 BSG(basigin, CD147, EMMPRIN, OK) 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며 RNA-seq 데이터 기반 Orthogonal 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036048-100 Anti-BSG Antibody, basigin (Ok blood group) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036048-25 Anti-BSG Antibody, basigin (Ok blood group) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: basigin (Ok blood group)
Supplier: Atlas Antibodies

IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data from tissues with high and low expression.
WB (Western Blot): Suitable for detection of BSG protein.

Polyclonal antibody against human BSG.

CD147, EMMPRIN, OK

항목	내용
Target Protein	basigin (Ok blood group)
Target Gene	BSG
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000023175 (51%), Rat ENSRNOG00000008414 (50%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

DLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIEN

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
Western Blot

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.